Anti-Mouse IL-1 beta Rabbit Recombinant Antibody proteintech 98179-1-RR
$147.00
In stock
SKU
98179-1-RR
IL 1beta, Il1b, 241364B3, IL 1 beta, Il 1b
| Host / Isotype: Rabbit / IgG | Class: Recombinant |
| Reactivity: Mouse And More (1) | Immunogen: CatNo: Eg1577 Product name: Recombinant Mouse IL-1 beta protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: N-6*His Domain: 118-269 aa of NM_008361.4 Sequence: VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS Predict reactive species |
| Applications: WB, FC (Intra) | Observed Molecular Weight: 31kDa |
| Formulation: PBS, Azide | GenBank Accession Number: IL-1 beta |
| Conjugate: Unconjugated | Gene Symbol: 16176 |
| Tested Applications: Positive FC (Intra) detected in | Gene ID (NCBI): Unconjugated |
| Application: Flow Cytometry (FC) (INTRA) | RRID: Liquid |
| Dilution: FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension | Conjugate: Protein A purfication |
| Tested Reactivity: Mouse | Form: P10749 |
| Host / Isotype: Rabbit / IgG | Background Information: Interleukin-1 is a pro-inflammatory cytokine with multiple biological effects. The IL-1 gene family encodes three proteins: IL-1α, IL-1β and their naturally occurring inhibitor Il-1RN. Interleukin 1β(IL-1β), mainly produced by blood monocytes and tissue macrophages, has been implicated in mediating both acute and chronic inflammation. IL-1β is known to be involved in a variety of cellular activities, including cell proliferation, differentiation and apoptosis. IL-1β is emerging as a key mediator of carcinogenesis that characterizes host-environment interactions (PMID: 8630372; PMID: 12401481; PMID: 23704929; PMID: 24618930). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
