Anti-Mouse GITR/TNFRSF18 Rabbit Recombinant Antibody proteintech 98466-3-RR
$59.00
In stock
SKU
98466-3-RR
CD357, GITR, Tnfrsf18, AITR, Glucocorticoid-induced TNFR-related protein
| Host / Isotype: Rabbit / IgG | Class: Recombinant |
| Reactivity: mouse | Immunogen: CatNo: Eg3695 Product name: Recombinant Mouse GITR/TNFRSF18 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 20-153 aa of NM_009400.2 Sequence: QPSVVEEPGCGPGKVQNGSGNNTRCCSLYAPGKEDCPKERCICVTPEYHCGDPQCKICKHYPCQPGQRVESQGDIVFGFRCVACAMGTFSAGRDGHCRLWTNCSQFGFLTMFPGNKTHNAVCIPEPLPTEQYGH Predict reactive species |
| Applications: IF, FC | Observed Molecular Weight: 25kDa |
| Formulation: PBS, Azide | GenBank Accession Number: CD357 |
| Conjugate: Unconjugated | Gene Symbol: 21936 |
| Tested Applications: Positive FC detected in | Gene ID (NCBI): Unconjugated |
| Application: Flow Cytometry (FC) | RRID: Liquid |
| Dilution: FC : 0.25 ug per 10^6 cells in a 100 ?l suspension | Conjugate: Protein A purification |
| Tested Reactivity: Mouse | Form: O35714-1 |
| Host / Isotype: Rabbit / IgG | Background Information: Glucocorticoid-induced TNFR-related protein (GITR), also known as CD357 or TNFRSF18, is a member of the tumor necrosis factor receptor (TNF-R) superfamily. GITR is expressed constitutively at high levels in T regulatory cells (Treg cells) and plays a key role in dominant immunological self-tolerance maintained by CD25+CD4+ regulatory T cells (PMID: 11812990). It is expressed at low levels on resting responder T cells. The expression of GITR on T cells can be upregulated upon activation (PMID: 15770698). GITR is activated by GITR ligand (GITRL) which is mainly expressed on APC. GITR-GITRL interactions could co-stimulate both responder T-cell functions and the suppressive functions of Treg cells (PMID: 16868552). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
