TREM2 Recombinant monoclonal antibody proteintech 83438-6-RR
$449.00
In stock
SKU
83438-6-RR
240384B7, TREM 2, TREM-2, Trem2a, Trem2b
| Host / Isotype: Rabbit / IgG | Class: Recombinant |
| Reactivity: Human And More (1) | Immunogen: CatNo: Eg0747 Product name: Recombinant human TREM2 protein Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 19-174 aa of BC032362 Sequence: HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRPSQGSHLPSCLSK Predict reactive species |
| Applications: WB, ELISA | Observed Molecular Weight: 222 aa, 25 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC032362 |
| Conjugate: Unconjugated | Gene Symbol: TREM2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 54209 |
| Application: Western Blot (WB) | RRID: AB_3671079 |
| Dilution: WB : 1:2000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: TREM2 (triggering receptor expressed on myeloid cells 2) is a cell surface receptor belongs to TREM family that is expressed on osteoclast, dendritic cells, macrophages, nature killers, neutrophils and microglia (PMID: 19302484). TREM2 is localized predominantly in the Golgi complex, but also shuttles to and from the cell surface in endocytic and exocytic vesicles (PMID: 16675145). TREM2 associates with DAP12 to initiate the intracellular signalling cascade via an immunoreceptor tyrosine-based activation motif (ITAM) domain and tyrosine-kinases (PMID: 23977213). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
