GLUT1 Recombinant monoclonal antibody proteintech 81463-1-RR
$449.00
In stock
SKU
81463-1-RR
SLC2A1, 6F14, GLUT-1, SLC2A1,GLUT1
| Host / Isotype: Rabbit / IgG | Class: Recombinant |
| Reactivity: Human And More (1) | Immunogen: CatNo: Ag16282 Product name: Recombinant human SLC2A1,GLUT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 216-280 aa of BC121804 Sequence: INRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQL Predict reactive species |
| Applications: WB, IHC, ELISA | Observed Molecular Weight: 492 aa, 54 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC121804 |
| Conjugate: Unconjugated | Gene Symbol: GLUT1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6513 |
| Application: Western Blot (WB) | RRID: AB_2923718 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: GLUT1, also known as SLC2A1, is a ubiquitously expressed glucose transporter and is responsible for the basal level of glucose uptake in most cell types. Human erythrocytes express the highest level of GLUT1. Defects in SLC2A1 are the cause of GLUT1 deficiency syndrome type 1 and type 2. High expression of GLUT1 has been reported to be a reliable immunohistochemical marker for juvenile hemangiomas. GLUT1 protein may appear as two or more distinct forms among 43 kDa to 55 kDa due to the different glycosylation states. And the conversion of the highly glycosylated form of GLUT1 to a less glycosylated form has been reported to correlate with differentiation (PMID: 8263524, 23302780). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
