SYN1 Polyclonal antibody proteintech 30549-1-AP
$449.00
In stock
SKU
30549-1-AP
Synapsin I, Brain protein 4.1, SYN1a, SYN1b, Synapsin 1
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse | Immunogen: CatNo: Ag31091 Product name: Recombinant human SYN1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 362-511 aa of NM_006950 Sequence: EIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMAQALPRQRQRDASPGRGSHGQTPSPGALPLGRQTSQQPAGPPAQQRPPPQGGPPQPGPGPQRQGPPLQQRPPPQGQQHLSGLGPPAGSPLPQRLPSP Predict reactive species |
| Applications: WB, IHC, ELISA | Observed Molecular Weight: 74 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: NM_006950 |
| Conjugate: Unconjugated | Gene Symbol: SYN1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6853 |
| Application: Western Blot (WB) | RRID: Unconjugated |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Liquid |
| Tested Reactivity: Human, Mouse | Form: Antigen affinity purification |
| Host / Isotype: Rabbit / IgG | Background Information: SYN1, also named Synapsin I, Brain protein 4.1, belongs to the Synapsin family. SYN1 is a neuronal phosphoprotein that coats synaptic vesicles, binds to the cytoskeleton, and is believed to regulate neurotransmitter release. The complex formed with NOS1 and CAPON proteins is necessary for specific nitric-oxid functions at a presynaptic level. Defects in SYN1 are a cause of epilepsy X-linked with variable learning disabilities and behavior disorders (XELBD). Synapsin I (SYN1) is composed of two isoforms, synapsin Ia and Ib, with molecular weights of 74 kDa and 70 kDa, respectively. |
Reviews
Write Your Own Review