JUN Polyclonal antibody proteintech 24909-1-AP
$449.00
In stock
SKU
24909-1-AP
AP 1, AP1, Activator protein 1, c Jun, jun oncogene
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Hamster And More (2) | Immunogen: CatNo: Ag17639 Product name: Recombinant human JUN protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 92-227 aa of BC068522 Sequence: PTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKE Predict reactive species |
| Applications: WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, ELISA | Observed Molecular Weight: 331 aa, 36 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC068522 |
| Conjugate: Unconjugated | Gene Symbol: JUN |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 3725 |
| Application: Western Blot (WB) | RRID: AB_2860574 |
| Dilution: WB : 1:1000-1:6000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Hamster | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: JUN is also named as c-Jun and AP1, belongs to the bZIP family and Jun subfamily. JUN, the most extensively studied protein of the activator protein-1 (AP-1) complex, is involved in numerous cell activities, such as proliferation, apoptosis, survival, tumorigenesis and tissue morphogenesis[PMID: 22180088]. JUN is a transcription factor that recognizes and binds to the enhancer heptamer motif 5'-TGA[CG]TCA-3'. It promotes activity of NR5A1 when phosphorylated by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation. JUN is a basic leucine zipper (bZIP) transcription factor that acts as homo- or heterodimer, binding to DNA and regulating gene transcription[PMID: 9732876]. In additon, extracellular signals can induce post-translational modifications of JUN, resulting in altered transcriptional activity and target gene expression[PMID:8464713]. More over, it has uncovered multiple layers of a complex regulatory scheme in which JUN is able to crosstalk, amplify and integrate different signals for tissue development and disease. Jun is predominantly nuclear, ubiquitinated Jun colocalizes with lysosomal proteins[PMID: 15469925]. This antibody is a rabbit polyclonal antibody raised against a region of human JUN. Both phosphorylated (p-c-Jun) and unphosphorylated forms of c-Jun, with sizes of 42-45 kDa and 36-39 kDa, respectively are obtain in some experiments. (PMID: 17210646) |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
