PARP14 Recombinant monoclonal antibody proteintech 84039-6-RR
$449.00
In stock
SKU
84039-6-RR
PARP 14, KIAA1268, BAL2, 241078C11
| Host / Isotype: Rabbit / IgG | Class: Recombinant |
| Reactivity: human, mouse | Immunogen: CatNo: Ag35007 Product name: Recombinant human PARP14 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1501-1640 aa of NM_017554 Sequence: SRDVMQARDEIEAMIKRVRLAKEQESRADCISEFIEWQYNDNNTSHCFNKMTNLKLEDARREKKKTVDVKINHRHYTVNLNTYTATDTKGHSLSVQRLTKSKVDIPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTC Predict reactive species |
| Applications: WB, IHC, ELISA | Observed Molecular Weight: 203kd |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: NM_017554 |
| Conjugate: Unconjugated | Gene Symbol: PARP14 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 54625 |
| Application: Western Blot (WB) | RRID: AB_3671606 |
| Dilution: WB : 1:500-1:2000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: PARP14 (poly (ADP-ribose) polymerase family, member 14) is a PARP family member that has roles in DNA repair, B cell regulation, and focal adhesion (PMID: 25753673). The largest of all the human PARPs is PARP14. PARP14 has been reported to regulate several different pathways involved in immunity, inflammation, and genome stability (PMID: 37703374). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
