NETO2 Recombinant monoclonal antibody proteintech 84222-2-RR
$449.00
In stock
SKU
84222-2-RR
241451E10, Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor class A domains protein 2, BTCL2, NEOT2, Neuropilin and tolloid-like protein 2
| Host / Isotype: Rabbit / IgG | Class: Recombinant |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag2971 Product name: Recombinant human NETO2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 378-525 aa of BC012381 Sequence: MACKTAFNKTGFQEVFDPPHYELFSLRDKEISADLADLSEELDNYQKMRRSSTASRCIHDHHCGSQASSVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKKSSYTFKQGHECPEQALEDRVMEEIPCEIYVRGREDSAQASISIDF Predict reactive species |
| Applications: WB, ELISA | Observed Molecular Weight: 525 aa, 59 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC012381 |
| Conjugate: Unconjugated | Gene Symbol: NETO2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 81831 |
| Application: Western Blot (WB) | RRID: AB_3671776 |
| Dilution: WB : 1:2000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Neuropilin and tolloid-like 2 (NETO2), a member of the subfamily of CUB domain and LDLa-containing proteins, was identified as an auxiliary protein of neuronal kainate receptors (KARs) and played critical roles in regulating the functions of KARs. It was also able to bind to the active oligomeric form of K+-Cl? cotransporter (KCC2) to enhance its recycling in hippocampal neurons. Recently, elevated mRNA levels of NETO2 were detected in several types of tumors. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
