DGAT1 Recombinant monoclonal antibody proteintech 82945-1-RR
$449.00
In stock
SKU
82945-1-RR
ACAT related gene product 1, AGRP1, ARGP1, DGAT, DGAT1, Diglyceride acyltransferase
| Host / Isotype: Rabbit / IgG | Class: Recombinant |
| Reactivity: Human, Mouse, Rat And More (1) | Immunogen: CatNo: Ag32717 Product name: Recombinant human DGAT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 200-300 aa of BC015762 Sequence: AHTILFLKLFSYRDVNSWCRRARAKAASAGKKASSAAAPHTVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWM Predict reactive species |
| Applications: WB, ELISA | Observed Molecular Weight: 488 aa, 55 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC015762 |
| Conjugate: Unconjugated | Gene Symbol: DGAT1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 8694 |
| Application: Western Blot (WB) | RRID: AB_3391728 |
| Dilution: WB : 1:2000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
