IGF2BP1 Polyclonal antibody proteintech 22803-1-AP
$449.00
In stock
SKU
22803-1-AP
Coding region determinant-binding protein, CRD-BP, IGF2 mRNA-binding protein 1, IGF2BP 1, IGF-II mRNA-binding protein 1
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (3) | Immunogen: CatNo: Ag18859 Product name: Recombinant human IGF2BP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 126-198 aa of BC156957 Sequence: YSNREQTRQAIMKLNGHQLENHALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPL Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA | Observed Molecular Weight: 577 aa, 63 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC156957 |
| Conjugate: Unconjugated | Gene Symbol: IGF2BP1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 10642 |
| Application: Western Blot (WB) | RRID: AB_2879173 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: IGF2BP1, also named as CRDBP, VICKZ1, ZBP1, is a 577 amino acid protein, which belongs to the RRM IMP/VICKZ family. IGF2BP1 can form homodimers and heterodimers with IGF2BP1 and IGF2BP3. IGF2BP1 is mainly expressed in the embryo, including in fetal liver, fetal lung, fetal kidney, fetal thymus and also expressed follicles of ovary, as well as in gonocytes of testis, spermatogonia, semen, oocytes and placenta. IGF2BP1 is Expressed in various cancers, including testis and lung cancers, as well as kidney, prostate and trachea cancers. IGF2BP1 as RNA-binding factor that recruits target transcripts to cytoplasmic protein-RNA complexes (mRNPs). It also modulates the rate and location at which target transcripts encounter the translational apparatus and shields them from endonuclease attacks or microRNA-mediated degradation. The calcualted molecular weight of IGF2BP1 is 63 kDa, but modified IGF2BP1 is about 65-70 kDa. |
Reviews
Write Your Own Review