EZH2 Polyclonal antibody proteintech 21800-1-AP
$449.00
In stock
SKU
21800-1-AP
KMT6, EZH1, ENX-1, ENX 1, Enhancer of zeste homolog 2
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (2) | Immunogen: CatNo: Ag16789 Product name: Recombinant human EZH2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 158-261 aa of BC010858 Sequence: HGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECT Predict reactive species |
| Applications: WB, IF/ICC, FC (Intra), IP, CoIP, ChIP, RIP, ELISA | Observed Molecular Weight: 751 aa, 86 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC010858 |
| Conjugate: Unconjugated | Gene Symbol: EZH2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 2146 |
| Application: Western Blot (WB) | RRID: AB_10858790 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: EZH2 (enhancer of zeste homologue 2, also known as KMT6) is a member of Polycomb group (PcG) family and encodes a histone methyl transferase that has an essential role in promoting histone H3 lysine 27 trimethylation (H3K27me3) and epigenetic gene silencing. EZH2 is important for cell proliferation and inhibition of cell differentiation, and is implicated in cancer progression. Overexpression of EZH2 is a marker of advanced and metastatic disease in many solid tumors, including prostate and breast cancer. This antibody detected EZH2 protein as a single band with a molecular weight (MW) of 91-100 kDa in multiple cell lines. The phosphorylation may result in the higher molecular weight (calculated MW as 80-86 kDa). (20935635, 21367748) |
Reviews
Write Your Own Review