BAD Polyclonal antibody proteintech 10435-1-AP
$449.00
In stock
SKU
10435-1-AP
BBC2, BBC6, Bcl2-associated agonist of cell death, Bcl-2-binding component 6, BCL2L8
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse And More (4) | Immunogen: CatNo: Ag0688 Product name: Recombinant human BAD protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 14-168 aa of BC001901 Sequence: DSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ Predict reactive species |
| Applications: WB, IHC, FC (Intra), ELISA | Observed Molecular Weight: 18 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC001901 |
| Conjugate: Unconjugated | Gene Symbol: BAD |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 572 |
| Application: Western Blot (WB) | RRID: AB_2061994 |
| Dilution: WB : 1:500-1:3000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: BAD, also named as BBC6 and BCL2L8, promotes cell death. It is successfully competes for the binding to Bcl-X(L), Bcl-2 and Bcl-W, thereby affecting the level of heterodimerization of these proteins with BAX. BAD can reverse the death repressor activity of Bcl-X(L), but not that of Bcl-2. It appears to act as a link between growth factor receptor signaling and the apoptotic pathways. |
Reviews
Write Your Own Review