SLC17A9 Recombinant monoclonal antibody proteintech 83505-1-RR
$449.00
In stock
SKU
83505-1-RR
Voltage-gated purine nucleotide uniporter SLC17A9, VNUT, Vesicular nucleotide transporter, FLJ23412, C20orf59
| Host / Isotype: Rabbit / IgG | Class: Recombinant |
| Reactivity: mouse, rat | Immunogen: CatNo: Ag24970 Product name: Recombinant human SLC17A9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-85 aa of BC025312 Sequence: MTLTSRRQDSQEARPECQAWTGTLLLGTCLLYCARSSMPICTVSMSQDFGWNKKEAGIVLSSFFWGYCLTQVVGGHLGDRIGGEK Predict reactive species |
| Applications: WB, IHC, IF, FC (Intra), ELISA | Observed Molecular Weight: 436 aa, 47 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC025312 |
| Conjugate: Unconjugated | Gene Symbol: SLC17A9 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 63910 |
| Application: Western Blot (WB) | RRID: AB_3671130 |
| Dilution: WB : 1:2000-1:16000 | Conjugate: Unconjugated |
| Tested Reactivity: Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
