Aquaporin 4 Polyclonal antibody proteintech 16473-1-AP
$449.00
In stock
SKU
16473-1-AP
AQP4, AQP 4, AQP-4, Aquaporin4, Aquaporin-4
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (2) | Immunogen: CatNo: Ag9561 Product name: Recombinant human AQP4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 208-323 aa of BC022286 Sequence: TGASMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV Predict reactive species |
| Applications: WB, IHC, IF-P, IF-Fro, IP, ELISA | Observed Molecular Weight: 323 aa, 35 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC022286 |
| Conjugate: Unconjugated | Gene Symbol: Aquaporin 4 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 361 |
| Application: Western Blot (WB) | RRID: AB_2827426 |
| Dilution: WB : 1:2000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Aquaporins are specialized water transport channels in plasma membranes of water-permeable tissues. Aquaporin-4 (AQP4) is the most abundant water channel in the human central nervous system and is important to fluid movements in brain. Aquaporin-4 exists as two isoforms, a long (M1) isoform with translation initiation at Met-1, and a shorter (M23) isoform with translation initiation at Met-23, with molecular weights around 35-37 kDa and 32-34 kDa, respectively. |
Reviews
Write Your Own Review