IPO7 Monoclonal antibody proteintech 67525-1-Ig
$449.00
In stock
SKU
67525-1-Ig
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag27257 Product name: Recombinant human IPO7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 879-1016 aa of NM_006391.2 Sequence: MHAEHENDSDDDDEAEDDDETEELGSDEDDIDEDGQEYLEILAKQAGEDGDDEDWEEDDAEETALEGYSTIIDDEDNPVDEYQIFKAIFQTIQNRNPVWYQALTHGLNEEQRKQLQDIATLADQRRAAHESKMIEKHGG Predict reactive species |
| Applications: WB, IHC, ELISA | Observed Molecular Weight: 120 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: NM_006391.2 |
| Conjugate: Unconjugated | Gene Symbol: IPO7 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 10527 |
| Application: Western Blot (WB) | RRID: AB_2882745 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgG1 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
