Ins1 Monoclonal antibody proteintech 67668-1-Ig
$449.00
In stock
SKU
67668-1-Ig
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: mouse, rat | Immunogen: CatNo: Ag29988 Product name: Recombinant mouse insulin1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 25-87 aa of NM_008386 Sequence: FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKR Predict reactive species |
| Applications: IHC, IF-P, ELISA | Observed Molecular Weight: 12 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: Ins1 |
| Conjugate: Unconjugated | Gene Symbol: 16333 |
| Tested Applications: Positive IHC detected in | Gene ID (NCBI): AB_2882864 |
| Application: Immunohistochemistry (IHC) | RRID: Unconjugated |
| Dilution: IHC : 1:2500-1:10000 | Conjugate: Liquid |
| Tested Reactivity: Mouse, Rat | Form: Protein G purification |
| Host / Isotype: Mouse / IgG1 | Background Information: insulin I is a peptide hormone that plays a vital role in the regulation of carbohydrate and lipid metabolism. The encoded precursor protein undergoes proteolytic cleavage to produce a disulfide-linked heterodimeric functional protein that is stored in secretory granules. An increase in blood glucose levels, among others, induces the release of insulin from the secretory granules. Mice deficient in the functional hormone encoded by this gene develop diabetes mellitus. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
