IFI16 Monoclonal antibody proteintech 67790-1-Ig
$449.00
In stock
SKU
67790-1-Ig
Ifi 16, IFI16, IFNGIP1, PYHIN2
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human And More (1) | Immunogen: CatNo: Ag30314 Product name: Recombinant human IFI16 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 580-729 aa of BC017059 Sequence: VCRNGFLEVYPFTLVADVNADRNMEIPKGLIRSASVTPKINQLCSQTKGSFVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 729 aa, 82 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC017059 |
| Conjugate: Unconjugated | Gene Symbol: IFI16 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 3428 |
| Application: Western Blot (WB) | RRID: AB_2918554 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: IFI16 is a member of a family of interferon-inducible nuclear proteins involved in transcriptional regulation functions as a transcriptional repressor. IFI16 may be involved in TP53-mediated transcriptional activation by enhancing TP53 sequence-specific DNA binding and modulating TP53 phosphorylation status. It has been reported that IFI16 participates in the regulation of autophagy, TP53-mediated cell death and innate immune response. IFI16 has different isoforms and 67790-1-Ig antibody detects proteins around 85-95 kDa in SDS-PAGE similar to papers. (PMID:?9718316, 14990579, 11146555, 22046441) |