ICAM4 Monoclonal antibody proteintech 67014-1-Ig
$449.00
In stock
SKU
67014-1-Ig
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, mouse | Immunogen: CatNo: Ag27628 Product name: Recombinant human ICAM4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 23-152 aa of BC029364 Sequence: ALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYKPPHSVILEPPVLKGRKYTLR Predict reactive species |
| Applications: WB, IHC, IF-P, ELISA | Observed Molecular Weight: 271 aa, 29 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC029364 |
| Conjugate: Unconjugated | Gene Symbol: ICAM4 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 3386 |
| Application: Western Blot (WB) | RRID: AB_2882330 |
| Dilution: WB : 1:20000-1:100000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: This gene encodes the Landsteiner-Wiener (LW) blood group antigen(s) that belongs to the immunoglobulin (Ig) superfamily, and that shares similarity with the intercellular adhesion molecule (ICAM) protein family. The protein migrate as a 42 kDa glycoprotein on SDS PAGE. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
