Ki-67 Polyclonal antibody proteintech 27309-1-AP
$449.00
In stock
SKU
27309-1-AP
KI67, MKI67, Antigen identified by monoclonal antibody Ki-67, Antigen KI-67, Ki 67
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human And More (5) | Immunogen: CatNo: Ag26266 Product name: Recombinant human KI67 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1201-1300 aa of NM_002417 Sequence: AGTLPGSKRQLQTPKEKAQALEDLAGFKELFQTPGHTEELVAAGKTTKIPCDSPQSDPVDTPTSTKQRPKRSIRKADVEGELLACRNLMPSAGKAMHTPK Predict reactive species |
| Applications: IHC, IF/ICC, IF-P, FC (Intra), ELISA | Observed Molecular Weight: 359 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: KI67 |
| Conjugate: Unconjugated | Gene Symbol: 4288 |
| Tested Applications: Positive IHC detected in | Gene ID (NCBI): AB_2756525 |
| Application: Immunohistochemistry (IHC) | RRID: Unconjugated |
| Dilution: IHC : 1:4000-1:16000 | Conjugate: Liquid |
| Tested Reactivity: Human | Form: Antigen affinity purification |
| Host / Isotype: Rabbit / IgG | Background Information: The Ki-67 protein (also known as MKI67) is a cellular marker for proliferation. Ki67 is present during all active phases of the cell cycle (G1, S, G2 and M), but is absent in resting cells (G0). Cellular content of Ki-67 protein markedly increases during cell progression through S phase of the cell cycle. Therefore, the nuclear expression of Ki67 can be evaluated to assess tumor proliferation by immunohistochemistry. It has been demonstrated to be of prognostic value in breast cancer. In head and neck cancer, several studies have reported an association between high proliferative activity and poorer prognosis. |
Reviews
Write Your Own Review