HINT1 Monoclonal antibody proteintech 67583-1-Ig
$449.00
In stock
SKU
67583-1-Ig
| Host / Isotype: Mouse / IgG2a | Class: Monoclonal |
| Reactivity: Human And More (1) | Immunogen: CatNo: Ag16662 Product name: Recombinant human HINT1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-126 aa of BC007090 Sequence: MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 14 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC007090 |
| Conjugate: Unconjugated | Gene Symbol: HINT1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 3094 |
| Application: Western Blot (WB) | RRID: AB_2882793 |
| Dilution: WB : 1:500-1:2000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG2a | Background Information: HINT1(Histidine triad nucleotide-binding protein 1) is also named as HINT, PKCI1, PRKCNH1,which is a member of the histidine triad (HIT) family, highly conserved in diverse species and ubiquitously expressed in mammalian tissues.It hydrolyzes adenosine 5'-monophosphoramidate substrates such as AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester and AMP-NH2. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
