P glycoprotein Polyclonal antibody proteintech 22336-1-AP
$449.00
In stock
SKU
22336-1-AP
ABCB1, ATP-binding cassette sub-family B member 1, ATP-dependent translocase ABCB1, EC:7.6.2.1, EC:7.6.2.2
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human And More (3) | Immunogen: CatNo: Ag17811 Product name: Recombinant human ABCB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 624-708 aa of BC130424 Sequence: KLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEW Predict reactive species |
| Applications: WB, IHC, IF, IP, CoIP, ELISA | Observed Molecular Weight: 1280 aa, 142 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC130424 |
| Conjugate: Unconjugated | Gene Symbol: P glycoprotein |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 5243 |
| Application: Western Blot (WB) | RRID: AB_2833023 |
| Dilution: WB : 1:500-1:1000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: ABCB1 (also known as P-gp/ P-glycoprotein, MDR1/multidrug-resistance 1) is a plasma membrane protein first discovered in multidrug resistant tumor cells. ABCB1 can extrude a large number of medically relevant compounds from cells and causes drug resistance. ABCB1 is expressed in a variety of human cancers as well as normal tissues including brain, and placenta. Overexpression of ABCB1 correlates with a negative prognosis in several types of cancer. For optimal WB detection with 22336-1-AP, we recommend to avoid boiling the sample after lysis. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
