DDX54 Monoclonal antibody proteintech 66664-1-Ig
$449.00
In stock
SKU
66664-1-Ig
| Host / Isotype: Mouse / IgG2a | Class: Monoclonal |
| Reactivity: human, mouse | Immunogen: CatNo: Ag25289 Product name: Recombinant human DDX54 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 778-881 aa of BC156669 Sequence: DDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAGRVRPELKTKQQILKQRRRAQKLHFLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKMRKRM Predict reactive species |
| Applications: WB, IHC, IF/ICC, FC (Intra), ELISA | Observed Molecular Weight: 98 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC156669 |
| Conjugate: Unconjugated | Gene Symbol: DDX54 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 79039 |
| Application: Western Blot (WB) | RRID: AB_2882019 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Mouse / IgG2a | Background Information: DDX54, also named as ATP-dependent RNA helicase DDX54, is a 881 amino acid protein, which contains 1 helicase ATP-binding domain and belongs to the DEAD box helicase family. DDX54/DBP10 subfamily. DDX54 localizes in nucleus and Interacts in a hormone-dependent manner with nuclear receptors. DDX54 has RNA-dependent ATPase activity and represses the transcriptional activity of nuclear receptors. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
