DCLK1 Monoclonal antibody proteintech 68234-1-Ig
$449.00
In stock
SKU
68234-1-Ig
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, mouse, rat, pig, rabbit | Immunogen: CatNo: Ag17110 Product name: Recombinant human DCLK1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 623-729 aa of BC152456 Sequence: LITMMLLVDVDQRFSAVQVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIALDHGFTIKRSGSLDYYQQPGMYWIRPPLLIRRGRFSDEDATRM Predict reactive species |
| Applications: WB, IHC, IF-P, FC (Intra), ELISA | Observed Molecular Weight: 729 aa, 81 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC152456 |
| Conjugate: Unconjugated | Gene Symbol: DCLK1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 9201 |
| Application: Western Blot (WB) | RRID: AB_2935321 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Pig, Rabbit | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: DCLK1 (Serine/threonine-protein kinase DCLK1) is also named as DCAMKL1, DCDC3A, KIAA0369 and belongs to the CAMK Ser/Thr protein kinase family. It is a microtubule-associated kinase that can undergo autophosphorylation and it also has microtubule-polymerizing activity that is independent of its protein kinase activity (PMID: 11124993). It plays a unique role in mitotic spindle integrity during early neurogenesis in radial glial cell proliferation and their radial process stability. DCLK1 is a unique marker for distinguishing tumor stem cells from intestinal normal stem cells (PMID: 23202126). This protein has 4 isoforms produced by alternative splicing with the molecular weight of 82 kDa, 81 kDa, 47 kDa and 48 kDa. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
