CISD1 Monoclonal antibody proteintech 68030-1-Ig
$449.00
In stock
SKU
68030-1-Ig
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, mouse, rat, pig, rabbit, chicken | Immunogen: CatNo: Ag8560 Product name: Recombinant human mitoNEET,CISD1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-108 aa of BC007043 Sequence: MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 108 aa, 12 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC007043 |
| Conjugate: Unconjugated | Gene Symbol: CISD1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 55847 |
| Application: Western Blot (WB) | RRID: AB_2918772 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Pig, Rabbit, Chicken | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: MitoNEET, also named CISD1, belongs to a previously uncharacterized ancient family of proteins for which the hallmark is the presence of a unique 39 amino acid CDGSH domain. It is a single-pass type III membrane protein, located in mitochondrion outer membrane and may play a role in regulating maximal capacity for electron transport and oxidative phosphorylation. MitoNEET is a recently identified drug target for a commonly prescribed diabetes drug, Pioglitazone. This antibody recognizing MitoNEET (calculated 12 kDa) as a 17 kDa protein may be due to its posttranslational modification or metal binding activity. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
