CD155/PVR Monoclonal antibody proteintech 66913-1-Ig
$449.00
In stock
SKU
66913-1-Ig
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human | Immunogen: CatNo: Ag28303 Product name: Recombinant human PVR protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 21-115 aa of BC015542 Sequence: WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRV Predict reactive species |
| Applications: WB, ELISA | Observed Molecular Weight: 45 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC015542 |
| Conjugate: Unconjugated | Gene Symbol: CD155/PVR |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 5817 |
| Application: Western Blot (WB) | RRID: AB_2882240 |
| Dilution: WB : 1:2000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: CD155, also known as PVR, is a type I transmembrane glycoprotein in the immunoglobulin superfamily. It contains three extracellular immunoglobulin-like domains, D1-D3, of which D1 is recognized by the virus. Mature human CD155 consists of a 323 amino acid extracellular domain with one N-terminal V-type and two C2-type Ig-like domains, a 24 amino acid transmembrane segment, and a 50 amino acid cytoplasmic tail. CD155 is thought to play a role in adhesion by interaction with the ECM component vitronectin as well as a role in NK killing of tumor cells. CD155 binds to two receptors of NK cells, CD96 and CD226, and accumulates at cell-cell contact sites, leading to the formation of mature immune synapses between NK cells and target cells. CD155 serves as the entry receptor for poliovirus and thereby mediates human susceptibility to poliovirus infection. |