CD100 Monoclonal antibody proteintech 66582-1-Ig
$449.00
In stock
SKU
66582-1-Ig
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human | Immunogen: CatNo: Ag26461 Product name: Recombinant human CD100 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 756-862 aa of BC054500 Sequence: YKGYLPRQCLKFRSALLIGKKKPKSDFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLSARDKPFDVKCELKFADSDADGD Predict reactive species |
| Applications: WB, IHC, ELISA | Observed Molecular Weight: 96 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC054500 |
| Conjugate: Unconjugated | Gene Symbol: SEMA4D/CD100 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 10507 |
| Application: Western Blot (WB) | RRID: AB_2881942 |
| Dilution: WB : 1:1000-1:3000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: CD100 (also known as SEMA4D), a 150 kDa homodimer, belongs to the family of immune semaphorins, and CD100 is abundantly expressed on resting T cells, NK cells, and antigen-presenting cells. As a transmembrane glycoprotein, it is digested to its soluble form, sCD100, by specific matrix metalloproteinases. CD100 has been reported that the expression levels of CD100, and one of its receptors, plexin-B1 (PLXNB1), are increased in head and neck, prostate, colon, breast, and lung cancers, and the interaction between them provides oncogenic signaling essential for tumor growth and metastasis. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
