IFN-gamma Polyclonal antibody proteintech 15365-1-AP
$449.00
In stock
SKU
15365-1-AP
IFNG, IFG, IFN gamma, IFN γ, IFNγ
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human And More (2) | Immunogen: CatNo: Ag8321 Product name: Recombinant human IFNG protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 22-166 aa of BC070256 Sequence: YCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ Predict reactive species |
| Applications: WB, IHC, IF, ELISA | Observed Molecular Weight: 166 aa, 19 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC070256 |
| Conjugate: Unconjugated | Gene Symbol: IFNG |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 3458 |
| Application: Western Blot (WB) | RRID: ENSG00000111537 |
| Dilution: WB : 1:1000-1:6000 | Conjugate: AB_2123037 |
| Tested Reactivity: Human | Form: Unconjugated |
| Host / Isotype: Rabbit / IgG | Background Information: IFN gamma (IFNG) is a soluble cytokine that is the only member of the type II class of IFN. It is secreted by Th1 cells, cytotoxic T cells and NK cells. The cytokine is associated with antiviral, immunoregulatory and anti-tumor properties and is a potent activator of macrophages. It plays crucial roles in pathogen clearance. Aberrant IFNG expression is associated with a number of autoinflammatory and autoimmune diseases. It has been identified in many studies as a biomarker for pleural tuberculosis (TB). Mutations in this gene are associated with aplastic anemia. |
Reviews
Write Your Own Review