AMPK Gamma 1 Monoclonal antibody proteintech 67182-1-Ig
$449.00
In stock
SKU
67182-1-Ig
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human, mouse, rat | Immunogen: CatNo: Ag28907 Product name: Recombinant human PRKAG1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 165-321 aa of BC000358 Sequence: LYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQA Predict reactive species |
| Applications: WB, ELISA | Observed Molecular Weight: 38 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC000358 |
| Conjugate: Unconjugated | Gene Symbol: AMPK Gamma 1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 5571 |
| Application: Western Blot (WB) | RRID: AB_2882478 |
| Dilution: WB : 1:5000-1:20000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: Protein kinase, AMP-activated, gamma 1 non-catalytic subunit (PRKAG1, synonyms: AMPKG, MGC8666) is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an catalytic subunit, and non-catalytic and subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and iAMP-activated protein kinase (AMPK) is a highly conserved heterotrimeric serine/threonine kinase widely characterised as a sensor of cellular energetic stress. AMPK is a heterotrimeric complex consisting of a catalytic α-subunit and two regulatory subunits (β and γ). AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. AMPK gamma 1 is one of the gamma regulatory subunits of AMPK. |
Reviews
Write Your Own Review