Tissue Factor/CD142 Monoclonal antibody proteintech 67056-1-Ig
$449.00
In stock
SKU
67056-1-Ig
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human | Immunogen: CatNo: Ag27563 Product name: Recombinant human F3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 113-251 aa of BC011029 Sequence: GNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE Predict reactive species |
| Applications: WB, IHC, ELISA | Observed Molecular Weight: 295 aa, 33 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC011029 |
| Conjugate: Unconjugated | Gene Symbol: F3 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 2152 |
| Application: Western Blot (WB) | RRID: AB_2882367 |
| Dilution: WB : 1:1000-1:6000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG1 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
