SMARCA4/BRG1 Monoclonal antibody proteintech 66561-1-Ig
$449.00
In stock
SKU
66561-1-Ig
SMARCA4, 2E6B6, ATP dependent helicase SMARCA4, ATP-dependent helicase SMARCA4, BAF190
| Host / Isotype: Mouse / IgG2b | Class: Monoclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag16256 Product name: Recombinant human SMARCA4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 207-298 aa of BC150298 Sequence: KRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTST Predict reactive species |
| Applications: WB, IF/ICC, IP, ChIP, ELISA | Observed Molecular Weight: 1647 aa, 185 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC150298 |
| Conjugate: Unconjugated | Gene Symbol: SMARCA4 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6597 |
| Application: Western Blot (WB) | RRID: AB_2881922 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgG2b | Background Information: SMARCA4, also named as BAF190A, BRG1, SNF2B and SNF2L4, belongs to the SNF2/RAD54 helicase family. SMARCA4 is a transcriptional coactivator cooperating with nuclear hormone receptors to potentiate transcriptional activation. It is a component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. It is also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
