PSMD9 Monoclonal antibody proteintech 67338-1-Ig

$449.00
In stock
SKU
67338-1-Ig

 

1H2G1, 26S proteasome non-ATPase regulatory subunit 9, p27, Rpn4

Host / Isotype: Mouse / IgG1 Class: Monoclonal
Reactivity: Human, Mouse, Rat And More (1) Immunogen: CatNo: Ag25654 Product name: Recombinant human PSMD9 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-102 aa of BC004213 Sequence: MSDEEARQSGGSSQAGVVTVSDVQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCEGYPRSDVDLYQVRTARHNIICLQNDHKAVMKQVEEALHQLHA Predict reactive species
 Applications: WB, IHC, IF/ICC, FC (Intra), ELISA Observed Molecular Weight: 27 kDa
Formulation: PBS, Azide, Glycerol GenBank Accession Number: BC004213
Conjugate: Unconjugated Gene Symbol: PSMD9
Tested Applications: Positive WB detected in Gene ID (NCBI): 5715
Application: Western Blot (WB) RRID: AB_2882596
Dilution: WB : 1:2000-1:10000 Conjugate: Unconjugated
Tested Reactivity: Human, Mouse, Rat Form: Liquid
Host / Isotype: Mouse / IgG1 Background Information: PSMD9 is a ubiquitous protein of eukaryotic cells and is a chaperon of the 26S proteasome complex, which degrades ubiquitinated proteins in eukaryotic cells and contributes to the degradation of intracellular proteins into antigenic peptides for antigen presentation by MHC class I cells. The 26S mammalian base sub-complex involves three distinct modules which have ATPase subunits distinctly associated to three chaperones, one of which is PSMD9 regulating the modules assembly. The PSMD9 ubiquitous regulatory role within the proteasome implies its potential pleiotropic effects within different physio-pathological systems. PSMD9 is known to form a stable subcomplex with PSMC3 and PSMC6, two of the AAA-ATPases, assisting in the assembly of the 20S and 19S particles to form the holo complex.

 

 

Reviews

Write Your Own Review
You're reviewing:PSMD9 Monoclonal antibody proteintech 67338-1-Ig
Your Rating
Copyright © 2025 Biogege, Inc. All rights reserved.