OMA1 Monoclonal antibody proteintech 67449-1-Ig
$449.00
In stock
SKU
67449-1-Ig
2010001O09Rik, DAB1, FLJ33782, MPRP 1, MPRP1, OMA1, YKR087C, ZMPOMA1
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human, Mouse And More (1) | Immunogen: CatNo: Ag11201 Product name: Recombinant human OMA1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 361-524 aa of BC012915 Sequence: ICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACADIRASSVFWQQMEFVDSLHGQPKMPEWLSTHPSHGNRVEYLDRLIPQALKIREMCNCPPLSNPDPRLLFKLSTKHFLEESEKEDLNITKKQKMDTLPIQKQEQIPLTYIVEKRTGS Predict reactive species |
| Applications: WB, ELISA | Observed Molecular Weight: 524 aa, 60 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC012915 |
| Conjugate: Unconjugated | Gene Symbol: OMA1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 115209 |
| Application: Western Blot (WB) | RRID: AB_2882683 |
| Dilution: WB : 1:1000-1:5000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: OMA1(Overlapping with the m-AAA protease 1 homolog) is also named as MPRP1(Metalloprotease-related protein 1) and belongs to the peptidase M48 family.It is a zinc metalloprotease that spans the inner mitochondrial membrane with a number of predicted membrane spanning domains and the 60 kDa form of OMA1 rapidly accumulated concomitantly with the cleavage of all OPA1 variants,and the 40 kDa form of OMA1 may be the inactive form, with the 60 kDa form being the active enzyme(PMID:20334834) |