ISG15 Monoclonal antibody proteintech 68408-1-Ig
$449.00
In stock
SKU
68408-1-Ig
G1P2, hUCRP, IFI15, IP17, ISG15, ISG15 ubiquitin like modifier, Ubiquitin like protein ISG15, UCRP
| Host / Isotype: Mouse / IgG2a | Class: Monoclonal |
| Reactivity: Human And More (1) | Immunogen: CatNo: Ag8953 Product name: Recombinant human ISG15 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-165 aa of BC009507 Sequence: MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS Predict reactive species |
| Applications: WB, IHC, ELISA | Observed Molecular Weight: 165 aa, 18 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC009507 |
| Conjugate: Unconjugated | Gene Symbol: ISG15 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 9636 |
| Application: Western Blot (WB) | RRID: AB_3085125 |
| Dilution: WB : 1:2000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG2a | Background Information: ISG15 is a ubiquitin-like protein that becomes conjugated to many cellular proteins upon activation by interferon-alpha (IFNA) and -beta (IFNB). ISG15 forms covalent conjugates with its target proteins in a process called ISGylation, which in mammals is known to play a role in antiviral immunity. ISG15 proteins possess two ubiquitin-like (UBL) domains and a highly conserved C-terminal LRGG sequence, the latter being known as the ubiquitin conjugation motif. Intracellular ISG15 are conjugated, via the LRGG motif, to target proteins through a process called ISGylation, which resembles largely ubiquitination, the process of formation of ubiquitin conjugates. Unconjugated extracellular ISG15, which are released from several types of human and murine cells, are known to possess cytokine-like activity. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
