FKBP2 Monoclonal antibody proteintech 66091-1-Ig
$449.00
In stock
SKU
66091-1-Ig
13 kDa FK506-binding protein, 2H7E8, EC:5.2.1.8, FK506-binding protein 2, FKBP 13
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, rat, pig | Immunogen: CatNo: Ag19113 Product name: Recombinant human FKBP2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-142 aa of BC003384 Sequence: MRLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL Predict reactive species |
| Applications: WB, IHC, FC (Intra), ELISA | Observed Molecular Weight: 142 aa, 16 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC003384 |
| Conjugate: Unconjugated | Gene Symbol: FKBP2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 2286 |
| Application: Western Blot (WB) | RRID: AB_11232416 |
| Dilution: WB : 1:500-1:1000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Rat, Pig | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: FKBP2 is also named as FKBP13 and belongs to the FKBP-type PPIase family. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. FKBP2 has a 21-amino acid signal peptide and appears to be membrane-associated(PMID:1713687). It is localized to the lumen of the endoplasmic reticulum (ER). FKBP12 and FKBP13 are highly similar proteins, of molecular masses 12 kDa and 13 kDa respectively, with approx.43 % amino acid identity. The strong homology between FKBP12 and FKBP13 suggests that they may share similar biological functions, although, apart from rotamase activity, details relating to the function of either protein are scant(PMID:8373365). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
