DDR2 Monoclonal antibody proteintech 67126-1-Ig
$449.00
In stock
SKU
67126-1-Ig
DDR2, Discoidin domain receptor 2, MIG20a, NTRKR3, TKT, TYRO10, Tyrosine protein kinase TYRO10
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human And More (1) | Immunogen: CatNo: Ag28340 Product name: Recombinant human DDR2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 291-398 aa of NM_001014796 Sequence: MFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNT Predict reactive species |
| Applications: WB, IF, ELISA | Observed Molecular Weight: 97 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: NM_001014796 |
| Conjugate: Unconjugated | Gene Symbol: DDR2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 4921 |
| Application: Western Blot (WB) | RRID: AB_2882426 |
| Dilution: WB : 1:1000-1:6000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: DDR2 (Discoidin domain receptor 2) belongs to the receptor tyrosine kinase (RTK) family and is activated by collagen-binding.DDR2 is implicated in several physiological and pathological processes, including wound healing, angiogenesis, ovulation, spermatogenesis, extracellular matrix (ECM) remodeling and fibrosis, and tumor progression (PMID: 25805889). Moreover, DDR2 is prominently present in the fibroblasts, smooth muscle cells, myofibroblasts, and chondrocytes (PMID: 37834343). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
