Betacellulin Monoclonal antibody proteintech 66683-1-Ig
$449.00
In stock
SKU
66683-1-Ig
BTC, Probetacellulin, 2H5E8
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human | Immunogen: CatNo: Ag26724 Product name: Recombinant human BTC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 32-118 aa of BC011618 Sequence: DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQ Predict reactive species |
| Applications: WB, IHC, ELISA | Observed Molecular Weight: 20 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC011618 |
| Conjugate: Unconjugated | Gene Symbol: BTC |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 685 |
| Application: Western Blot (WB) | RRID: AB_2882037 |
| Dilution: WB : 1:5000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: Betacellulin (BTC), a member of the epidermal growth factor (EGF) family, binds and activates ErbB1 and ErbB4 homodimers. BTC is synthesized primarily as a transmembrane precursor, which is then processed to mature molecule by proteolytic events. This protein is a ligand for the EGF receptor. BTC was expressed in tumors and involved in tumor growth progression. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
