BCLAF1 Monoclonal antibody proteintech 67860-1-Ig
$449.00
In stock
SKU
67860-1-Ig
1D6G7, Bcl-2-associated transcription factor 1, BCLAF1 and THRAP3 family member 1, Btf, KIAA0164
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag25210 Product name: Recombinant human BCLAF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 881-920 aa of BC132780 Sequence: SGSSPKWTHDKYQGDGIVEDEEETMENNEEKKDRRKEEKE Predict reactive species |
| Applications: WB, IHC, IF/ICC, FC (Intra), ELISA | Observed Molecular Weight: 920 aa, 106 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC132780 |
| Conjugate: Unconjugated | Gene Symbol: BCLAF1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 9774 |
| Application: Western Blot (WB) | RRID: AB_2918618 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: BCLF1, also named as Bcl-2-associated transcription factor 1, is a 920 amino acid protein, which Interacts with Bcl-2 related proteins, EMD, with the adenovirus E1B 19 kDa protein and with DNA. BCLF1 as a death-promoting transcriptional repressor may be involved in cyclin-D1/CCND1 mRNA stability through the SNARP complex which associates with both the 3'end of the CCND1 gene and its mRNA. The calculated molecular weight of BCLF1 is a 110 kDa, but the modified BCLF1 protein is about 140-150 kDa. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
