Annexin A11 Monoclonal antibody proteintech 68089-1-Ig
$449.00
In stock
SKU
68089-1-Ig
ANXA11, 1A3C4, 56 kDa autoantigen, Annexin 11, Annexin XI
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, mouse, rat, pig, rabbit | Immunogen: CatNo: Ag31839 Product name: Recombinant human ANXA11 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-180 aa of BC007564 Sequence: MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANMPNLYPGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQPPGAYPGQPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVT Predict reactive species |
| Applications: WB, IHC, IF/ICC, FC (Intra), ELISA | Observed Molecular Weight: 56 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC007564 |
| Conjugate: Unconjugated | Gene Symbol: Annexin A11 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 311 |
| Application: Western Blot (WB) | RRID: AB_2918826 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Pig, Rabbit | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: Annexin A11 (Anxa11) is one member of annexins that are Ca2+-regulated phospholipid-binding proteins. Annexin A11 plays an important role in cell division, differentiation, apoptosis, vesicle trafficking and Ca2+ signaling (PMID: 31610865). ANXA11, an RNA granule-associated phosphoinositide-binding protein, acts as a molecular tether between RNA granules and lysosomes (PMID: 31539493). Annexin A11 dysregulation is involved in the progression, drug-resistance, recurrence of systemic autoimmune disease and cancer. Annexin A11, is involved in a variety of cellular functions including mRNA transport and translation, endocytosis, exocytosis, and plasma membrane repair (PMID: 38896345). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
