Alpha B Crystallin Monoclonal antibody proteintech 68001-1-Ig
$449.00
In stock
SKU
68001-1-Ig
Alpha crystallin B chain, Alpha(B) crystallin, CRYA2, CRYAB, crystallin, alpha B, CTPP2, Heat shock protein beta 5, HSPB5, Rosenthal fiber component
| Host / Isotype: Mouse / IgG2b | Class: Monoclonal |
| Reactivity: Human, Mouse, Rat And More (1) | Immunogen: CatNo: Ag8656 Product name: Recombinant human aB-Crystallin protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-175 aa of BC007008 Sequence: MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK Predict reactive species |
| Applications: WB, IHC, IP, ELISA | Observed Molecular Weight: 175 aa, 20 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC007008 |
| Conjugate: Unconjugated | Gene Symbol: Alpha B Crystallin |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 1410 |
| Application: Western Blot (WB) | RRID: AB_2918749 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgG2b | Background Information: Alpha B-crystallin, encoded by CRYAB gene, is multifunctional, serving as both a major structural protein in the lens and a small heat-shock protein in other tissues in mammals. Alpha B-crystallin may contribute to the transparency and refractive index of the lens. Single nucleotide polymorphisms (SNPs) in the promoter region of CRYAB gene have been associated with in multiple sclerosis. Mutations in the CRYAB gene cause distinct clinical phenotypes including isolated posterior polar cataract, myofibrillar myopathy, cardiomyopathy, or a multisystemic disorder combining all these features. Impairment of alpha-B crystallin dimerization may be relevant to the pathogenesis of these disorders. |
Reviews
Write Your Own Review