TOM22 Monoclonal antibody proteintech 66562-1-Ig
$449.00
In stock
SKU
66562-1-Ig
TOMM22, 1C2B11, 1C9 2, hTom22, MST065
| Host / Isotype: Mouse / IgG2a | Class: Monoclonal |
| Reactivity: Human And More (1) | Immunogen: CatNo: Ag1797 Product name: Recombinant human TOMM22 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC009363 Sequence: MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI Predict reactive species |
| Applications: WB, IHC, IF/ICC, FC (Intra), ELISA | Observed Molecular Weight: 15 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC009363 |
| Conjugate: Unconjugated | Gene Symbol: TOMM22/Tom22 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 56993 |
| Application: Western Blot (WB) | RRID: AB_2881923 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG2a | Background Information: Tom22 is a central receptor component of the translocase of the outer membrane of mitochondria responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. It is showed in UniProt that phosphorylation is performed at three positions of this protein which may increase the molecular weight. Catalog#66562-1-Ig recognises ?the? 22 kDa ?protein larger than the calculated MW which is 15 kDa. Besides, it has been reported the MV of TOMM22 is 22 kDa (PMID:19285029). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
