SUMO2/3 Monoclonal antibody proteintech 67154-1-Ig
$449.00
In stock
SKU
67154-1-Ig
SUMO2, Small ubiquitin-related modifier 2, Sentrin-2, Sentrin2, Sentrin 2
| Host / Isotype: Mouse / IgG2b | Class: Monoclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag28672 Product name: Recombinant human SUMO2/3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-95 aa of BC008450 Sequence: MADEKPKEGVKTENNNHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 11 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC008450 |
| Conjugate: Unconjugated | Gene Symbol: SUMO2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6613 |
| Application: Western Blot (WB) | RRID: AB_2882451 |
| Dilution: WB : 1:1000-1:6000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgG2b | Background Information: Ubiquitin is most famous for its function in targeting proteins for degradation by the 26S proteasome, ubiquitin needs to be attached to a substrate in chains (polyubiquitylation) before being recognized by proteasome. Similarly, SUMO (small ubiquitin-related modifier) can be linked to substrates in chains (polysumoylation), SUMO modification has been implicated in many important cellular processes including the control of genome stability, signal transduction, targeting to and formation of nuclear compartments, cell cycle and meiosis. There are 4 confirmed SUMO isoforms in human, SUMO-1, SUMO-2, SUMO-3 and SUMO-4. SUMO-2 and SUMO-3 are nearly identical but are distinct from SUMO-1. SUMO2/3 conjugation was recently widely involved in neuroprotective activities. A substitution (M55V) of SUMO4 was strongly associated with the pathogenesis of type 1 diabetes (T1D) involving NF kappa B related mechanisms. |
Reviews
Write Your Own Review