STRA8 Monoclonal antibody proteintech 68071-1-Ig
$449.00
In stock
SKU
68071-1-Ig
stimulated by retinoic acid gene 8 homolog (mouse), Stimulated by retinoic acid gene 8 protein homolog
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, mouse, rabbit | Immunogen: CatNo: Ag29680 Product name: Recombinant human STRA8 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 187-330 aa of NM_182489 Sequence: NLSEERKASLRQAWAQKHRGPATLAEACREPACAEGSVKDSGVDSQGASCSLVSTPEEILFEDAFDVASFLDKSEVPSTSSSSSVLASCNPENPEEKFQLYMQIINFFKGLSCANTQVKQEASFPVDEEMIMLQCTETFDDEDL Predict reactive species |
| Applications: WB, IF, ELISA | Observed Molecular Weight: 37 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: NM_182489 |
| Conjugate: Unconjugated | Gene Symbol: STRA8 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 346673 |
| Application: Western Blot (WB) | RRID: AB_2918812 |
| Dilution: WB : 1:1000-1:6000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rabbit | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: Stimulated by retinoic acid?8 (Stra8), one of genes induced by retinoic acid (RA), is required for the meiotic initiation of male spermatogenesis. Stimulated by Retinoic Acid Gene 8 (STRA8) protein has been proposed as the molecular effector of Retinoic Acid (RA) involved in meiosis-inductive activity. Stra8 is a 45-kDa vertebrate-specific gene, without significant homologous proteins, expressed in the cytoplasm and nuclei of germ cells between mitosis and meiosis and presents exclusively in the embryonic and postnatal gonads of mammals. (PMID:?30106128, PMID:?31253359) |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
