CRABP2 Monoclonal antibody proteintech 66468-1-Ig
$449.00
In stock
SKU
66468-1-Ig
1A5F3, Cellular retinoic acid binding protein II, Cellular retinoic acid-binding protein 2, Cellular retinoic acid-binding protein II, CRABP II
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, mouse, rat, pig | Immunogen: CatNo: Ag0309 Product name: Recombinant human CRABP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-138 aa of BC001109 Sequence: MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE Predict reactive species |
| Applications: WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA | Observed Molecular Weight: 16 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC001109 |
| Conjugate: Unconjugated | Gene Symbol: CRABP2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 1382 |
| Application: Western Blot (WB) | RRID: AB_2881836 |
| Dilution: WB : 1:2500-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Pig | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: Cellular retinoic acid binding protein 2 (CRABP2, synonyms: RBP6, CRABP-II). A number of specific carrier proteins for members of the vitamin A family have been discovered. Cellular retinoic acid binding proteins (CRABP) are low molecular weight proteins whose precise function remains unknown. CRABP2 is important in retinoic acid-mediated regulation of human skin growth and differentiation. It has been postulated that the CRABP2 gene is transcriptionally regulated by a newly synthesized regulatory protein. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
