CD24 Monoclonal antibody proteintech 67627-1-Ig
$449.00
In stock
SKU
67627-1-Ig
1H5C4, CD24A
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human | Immunogen: CatNo: Ag11679 Product name: Recombinant human CD24 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-80 aa of BC007674 Sequence: MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS Predict reactive species |
| Applications: WB, IF/ICC, ELISA | Observed Molecular Weight: 8 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC007674 |
| Conjugate: Unconjugated | Gene Symbol: CD24 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 100133941 |
| Application: Western Blot (WB) | RRID: AB_2882828 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: CD24 (known as heat stable antigen) is a small highly glycosylated GPI-linked sialoprotein. It is normally expressed at the surface of most B lymphocytes and differentiating neuroblasts, and it is also up-regulated in a wide variety of cancers. Studies have shown that CD24 functions in the regulation of B-cell apoptosis, leukocyte signal transduction, and leukocyte adhesion. Since it is highly glycosylated, the apparent molecular weight of CD24 could be variable, ranging from 30 kDa to 70 kDa. (Ref: Akihiko Sano, MD., 2009) |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
