P2RY1 Monoclonal antibody proteintech 67654-1-Ig
$449.00
In stock
SKU
67654-1-Ig
ADP receptor, ATP receptor, P2Y purinoceptor 1, P2Y1, Purinergic receptor
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, mouse, rat, pig, rabbit | Immunogen: CatNo: Ag12762 Product name: Recombinant human P2RY1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 281-373 aa of BC074785 Sequence: TMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDTSL Predict reactive species |
| Applications: WB, IHC, IF-P, ELISA | Observed Molecular Weight: 373 aa, 42 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC074785 |
| Conjugate: Unconjugated | Gene Symbol: P2RY1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 5028 |
| Application: Western Blot (WB) | RRID: AB_2882853 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Pig, Rabbit | Form: Liquid |
| Host / Isotype: Mouse / IgG1 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
