Myosin Light Chain 2/MLC-2V Monoclonal antibody proteintech 60229-1-Ig
$449.00
In stock
SKU
60229-1-Ig
MLC 2v, MYL2, MLC-2s/v, MLC-2, MLC2
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, mouse, rat, pig, rabbit | Immunogen: CatNo: Ag1356 Product name: Recombinant human MYL2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-166 aa of BC015821 Sequence: MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 19 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC015821 |
| Conjugate: Unconjugated | Gene Symbol: Myosin Light Chain 2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 4633 |
| Application: Western Blot (WB) | RRID: AB_2881356 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Pig, Rabbit | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: MYL2, also named as MLC-2v and MLC-2, is ventricular/cardiac muscle isoform. Defects in MYL2 are the cause of cardiomyopathy familial hypertrophic type 10 (CMH10). Defects in MYL2 are the cause of cardiomyopathy familial hypertrophic with mid-left ventricular chamber type 2 (MVC2). MYL2 has been widely used as a marker of mature ventricular cardiomyocytes. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
