GLUT2 Monoclonal antibody proteintech 66889-1-Ig
$449.00
In stock
SKU
66889-1-Ig
GLUT 2, GLUT2, SLC2A2
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human, Rat, Mouse And More (1) | Immunogen: CatNo: Ag14551 Product name: Recombinant human SLC2A2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 69-128 aa of BC060041 Sequence: SPRYLYIKLDEEVKAKQSLKRLRGYDDVTKDINEMRKEREEASSEQKVSIIQLFTNSSYR Predict reactive species |
| Applications: WB, IHC, IF, ELISA | Observed Molecular Weight: 57 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC060041 |
| Conjugate: Unconjugated | Gene Symbol: GLUT2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6514 |
| Application: Western Blot (WB) | RRID: AB_2918478 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Rat, Mouse | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: GLUT2 is a member of glucose transporters or GLUTs which catalyze the glucose transport across plasma membrane. GLUT2 is selectively expressed in hepatocytes, pancreatic beta cells, and absorptive renal and intestinal epithelial cells. GLUT2 is required to maintain normal glucose homeostasis and normal function and development of the endocrine pancreas. Its absence leads to symptoms characteristic of non-insulin-dependent diabetes mellitus. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
