DAPK1 Monoclonal antibody proteintech 67815-1-Ig
$449.00
In stock
SKU
67815-1-Ig
1E2F9, DAP kinase 1, DAPK, Death-associated protein kinase 1, EC:2.7.11.1
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag29838 Product name: Recombinant human DAPK1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 638-798 aa of BC113660 Sequence: ALTTDGKTAEDLARSEQHEHVAGLLARLRKDTHRGLFIQQLRPTQNLQPRIKLKLFGHSGSGKTTLVESLKCGLLRSFFRRRRPRLSSTNSSRFPPSPLASKPTVSVSINNLYPGCENVSVRSRSMMFEPGLTKGMLEVFVAPTHHPHCSADDQSTKAIDI Predict reactive species |
| Applications: WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA | Observed Molecular Weight: 1430 aa, 160 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC113660 |
| Conjugate: Unconjugated | Gene Symbol: DAPK1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 1612 |
| Application: Western Blot (WB) | RRID: AB_2918578 |
| Dilution: WB : 1:1000-1:4000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: DAPK1(Death-associated protein kinase 1) is a stress-activated tumor suppressor protein that plays a role in both proapoptotic or antiapoptotic signal transduction pathways. Loss of DAPK1 expression is associated with a selective advantage fortumor cells to resist apoptotic stimuli, allowing them to separate from the original tumor; from this point of view, DAPK1 could be considered a tumor metastases inhibitor gene(PMID:17319784). |
Reviews
Write Your Own Review