ACADM Monoclonal antibody proteintech 67742-1-Ig
$449.00
In stock
SKU
67742-1-Ig
1A11G6, ACAD, ACAD 1, ACAD1, EC:1.3.8.7
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human, Rat, Pig And More (1) | Immunogen: CatNo: Ag30620 Product name: Recombinant human ACADM protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 205-352 aa of BC005377 Sequence: ARSDPDPKAPANKAFTGFIVEADTPGIQIGRKELNMGQRCSDTRGIVFEDVKVPKENVLIGDGAGFKVAMGAFDKTRPVVAAGAVGLAQRALDEATKYALERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQRAAWEVDSGRRNTY Predict reactive species |
| Applications: WB, IHC, IF-P, ELISA | Observed Molecular Weight: 421 aa, 47 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC005377 |
| Conjugate: Unconjugated | Gene Symbol: ACADM |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 34 |
| Application: Western Blot (WB) | RRID: AB_2918511 |
| Dilution: WB : 1:2000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Rat, Pig | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: ACADM, also named as MCAD, belongs to the acyl-CoA dehydrogenase family. This enzyme is specific for acyl chain lengths of 4 to 16. It catalyzes the reaction: Acyl-CoA + acceptor = 2,3-dehydroacyl-CoA + reduced acceptor. Defects in ACADM are the cause of medium-chain acyl-CoA dehydrogenase deficiency (MCAD deficiency). This protein can exsit as a dimer(PMID:8962055). This antibody is specific to ACADM. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
