SSTR5 Monoclonal antibody proteintech 66772-1-Ig

$449.00
In stock
SKU
66772-1-Ig

 

somatostatin receptor 5, Somatostatin receptor type 5, SS 5 R, SS5 R, SS5R, SST5, SSTR5

Host / Isotype: Mouse / IgG1 Class: Monoclonal
Reactivity: Human, Mouse, Rat And More (3) Immunogen: CatNo: Ag18615 Product name: Recombinant human SSTR5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 302-364 aa of BC146576 Sequence: VLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL Predict reactive species
 Applications: WB, IF-P, CoIP, ELISA Observed Molecular Weight: 364 aa, 39 kDa
Formulation: PBS, Azide, Glycerol GenBank Accession Number: BC146576
Conjugate: Unconjugated Gene Symbol: SSTR5
Tested Applications: Positive WB detected in Gene ID (NCBI): 6755
Application: Western Blot (WB) RRID: AB_2882118
Dilution: WB : 1:1000-1:6000 Conjugate: Unconjugated
Tested Reactivity: Human, Mouse, Rat Form: Liquid
Host / Isotype: Mouse / IgG1 Background Information: Somatostatin is a widely distributed peptide with a broad range of biological actions. Two biological forms of somatostatin exist: somatostatin-14 and -28. Somatostatin receptors (SSTR1, 2A and B, 3, 4 and 5) belong to the G protein coupled receptor family and have a wide expression pattern in both normal tissues and solid tumors (PMID: 23872332). SSTR5 has greater affinity for somatostatin-28 than somatostatin-14 (PMID: 8373420).

 

 

Reviews

Write Your Own Review
You're reviewing:SSTR5 Monoclonal antibody proteintech 66772-1-Ig
Your Rating
Copyright © 2025 Biogege, Inc. All rights reserved.